PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4BL_9422485B3.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 375aa    MW: 40510.7 Da    PI: 7.5387
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4BL_9422485B3.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.48.3e-10179233559
                            CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                 bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevakl 59 
                            kr++r   NR +A rs +RK  ++ eLe+kv++L++e ++L  +l   +     l
  Traes_4BL_9422485B3.2 179 KRAKRILANRQSAARSKERKARYMTELERKVQTLQTEATTLSAQLTLFQRDTTGL 233
                            9****************************************99988776665555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.3E-15175239IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.668177240IPR004827Basic-leucine zipper domain
PfamPF001701.6E-8179233IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.37E-10179230No hitNo description
Gene3DG3DSA:1.20.5.1701.9E-8179234No hitNo description
CDDcd147032.46E-20180229No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 375 aa     Download sequence    Send to blast
MQQPKPADPP GRPFPPPSPS MAAAATAMRG AHHRRARSEV AFHLPDDLDI GGGADGDGSA  60
GFDEIGSEDD LFSTFMDIEK ISSGPAAGSD RDRDRAAETS SPPRPKHRYS SSXRAAEPSS  120
PPRPKHRYSS SVDGSGLFSA AGSAARRDAA AAQALADVLE AKKAMSPEQL AELAAIDPKR  180
AKRILANRQS AARSKERKAR YMTELERKVQ TLQTEATTLS AQLTLFQRDT TGLSSENAEL  240
KIRLQAMEQQ AQLRDALNDA LKQEVERLKM ATGEMSNSSD AYSVGLQHVL YNSSFFPQSQ  300
QNTAQHQGGA RFPPPFHPPH PNVPNHQMLS HPNTLSDIMQ QDHLARLQGL DISKGHPVVK  360
SESSSISASE SSSTF
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00303DAPTransfer from AT2G40620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3692850.0AK369285.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2088F01.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003557964.10.0PREDICTED: transcription factor RF2b
SwissprotQ6S4P41e-162RF2B_ORYSJ; Transcription factor RF2b
TrEMBLW5E5G50.0W5E5G5_WHEAT; Uncharacterized protein
STRINGMLOC_60045.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26833683
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40620.11e-72bZIP family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]